PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00043.1.g05000.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 430aa    MW: 47059.4 Da    PI: 7.028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00043.1.g05000.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.33.4e-28166220156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k +++Wtp+LH+rFv+aveqL G++kA+P++ile+m+++gLt+++++SHLQkYR++
  Zjn_sc00043.1.g05000.1.sm.mk 166 KRKVDWTPDLHRRFVQAVEQL-GIDKAVPSRILEIMGIEGLTRHNIASHLQKYRSH 220
                                   5799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.937163222IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-27164223IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-27166220IPR006447Myb domain, plants
SuperFamilySSF466891.33E-17166223IPR009057Homeodomain-like
PfamPF002494.6E-8169218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MLEVLRSPGS KAADQLHVVD AGFPTSTDQC GSGGDEFMLD GENLLDYIDF TCCDVPSFFD  60
ADGDILPDLE TELLAEFEDH ERGGGKPPDD VASSSQGDHH HHKEDEERLL LQVEEEEGQT  120
AQTKKSGSGD EVSLASAVTS TDTSKSSSAS AEKKKKKKRS KNSNGKRKVD WTPDLHRRFV  180
QAVEQLGIDK AVPSRILEIM GIEGLTRHNI ASHLQKYRSH RKHLMAQEAE AASWAKKRQM  240
YAAAPGAPRL TKDMPPAAAA PWVVPTTIRF PSPPFGRPLH VWGHPSTALE ATAAPMLPVW  300
PRHLAPVDRA YWHQPQYNGA RKWGPMTQGT PCVPPPIMPR FPTPPVPGTR MPHPMYRPPM  360
PPPPQITSSN LATLQLRLDA HPSKESIDAA IGDVLAKPWL PLPLGLKPPS LDSVTSELHK  420
QGIPKIPPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-14166218557ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152158KKKKKKR
2154161KKKKRSKN
3154167KKKKRSKNSNGKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535712e-51AK353571.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1001B16.
GenBankAK3535752e-51AK353575.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1001C10.
GenBankAK3615332e-51AK361533.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1142P20.
GenBankJF9519492e-51JF951949.1 Triticum aestivum clone TaMYB66 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967344.11e-132PREDICTED: probable transcription factor GLK2
SwissprotQ5NAN51e-100GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLK3XHG51e-132K3XHG5_SETIT; Uncharacterized protein
STRINGSi001336m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.15e-54GBF's pro-rich region-interacting factor 1